DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb9h

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:404 Identity:81/404 - (20%)
Similarity:167/404 - (41%) Gaps:73/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMH-------YRG 73
            :|.|......|...:.....::|:.:|...|.|::..:.:|.:.|.:.||.:|:|       ::|
Mouse     5 SQANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDEDVHQG 69

  Fly    74 THLSEY---KPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYR---VFMRHTEGRARNIA-F 131
            ..|..:   |...|| :.:::        ..|.:|....::...::   :...|:|....:.| .
Mouse    70 FQLLLHNLNKQNNQK-YCLTM--------ANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEA 125

  Fly   132 AREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNA 196
            |.|....:|.:.|.:...:|..::.:......::.:|.||::|:.:|.:.|....|....|::|.
Mouse   126 AEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINK 190

  Fly   197 TKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSV 261
            .::..:.||..:.......:..::|..:::|:...||..:::.||            :.::|..|
Mouse   191 KETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPD------------EGVDISKV 243

  Fly   262 ARNLTM--------------MDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNT 312
            ..|||.              .:..|..|||::..|.:::...:.:||.::|..||:..:.:....
Mouse   244 ENNLTFEKLTAWTKPEFMNRTEFHVYYPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKE 308

  Fly   313 NFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKY-----------FLATHPFAFYIID 366
            |..:...:|....|..|:|     |:....|      .|::           |.|.|||.|:|:.
Mouse   309 NLCLSEFVHKCVVEVNEEG-----TEAAAAS------AVEFIFLCSGPDPETFCADHPFLFFIMH 362

  Fly   367 NT--SIYFAGHVTS 378
            :|  ||.|.|..:|
Mouse   363 STTNSILFCGRFSS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 78/391 (20%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 79/398 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.