DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINB13

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:389 Identity:79/389 - (20%)
Similarity:156/389 - (40%) Gaps:63/389 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFA------------MS 90
            ||.||...|.:::..:.:|.....:.|:.:..|      ||.:.|:.:|.|            ..
Human    26 NIFFSPVGILTAIGMVLLGTRGATASQLEEVFH------SEKETKSSRIKAEEKEVVRIKAEGKE 84

  Fly    91 VKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLD------------------ 137
            ::.........:.::.:..|::.:|.:.:.:.....:...|.::.||                  
Human    85 IENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA 149

  Fly   138 ------EVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNA 196
                  ::|::...:..|:|..:..:.....:::.:|||.::|...|:|.|..|.|...:|.:|.
Human   150 ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNK 214

  Fly   197 TKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNIL-- 259
            :.|..:.||.:...|:|..|.:|:|..:.:|:.:.||.|.::.|:..|||..:..|:....::  
Human   215 STSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEW 279

  Fly   260 SVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIH--- 321
            :...::....|.:.:|:|::....:|......||:.|.|...|:..:.:...:.......:|   
Human   280 TSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSF 344

  Fly   322 -VVTFEFQE----QGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
             .||.|..|    .|||...|........|         ..|||.|:|..|  .||.|.|..:|
Human   345 VAVTEEGTEAAAATGIGFTVTSAPGHENVH---------CNHPFLFFIRHNESNSILFFGRFSS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 78/385 (20%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 79/389 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.