DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINB9

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:362 Identity:80/362 - (22%)
Similarity:164/362 - (45%) Gaps:30/362 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAMSVKKAP---VA 97
            :.|:..|...|.|::..:.:|.:.:.:.|:.:|:   ..:..|...:..:.....|.||.   :.
Human    25 SHNVFCSPVSISSALAMVLLGAKGNTATQMAQAL---SLNTEEDIHRAFQSLLTEVNKAGTQYLL 86

  Fly    98 KSLTRFYVRQNMK-MSTEYRVFMRHTEGRARNIAF---AREQLDEVNTFYSHEMGEQIGQVVKES 158
            ::..|.:..:..: :||.....::......:.::|   |.|....:||:.|.:...:|.:::..|
Human    87 RTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGS 151

  Fly   159 WWKPNSQGLLVNAIFFNLSWERTFNPEATYPRE--FRVNATKSVMIPMMHEDSKFAFGILGNLKA 221
            .....::.:|||||:|...|...|  :.||.||  |::|..:...:.||::::.|....:|.::|
Human   152 SIDAETRLVLVNAIYFKGKWNEPF--DETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRA 214

  Fly   222 TAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARN--LTMMDVFVGIPKFKIHSDLE 284
            ..:.:|::..:|.:|::.||....|:.::..|....:.:..:.  :...:|.|.:||||:..|.:
Human   215 QLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYD 279

  Fly   285 LSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTF- 348
            :......:||.|.|:..|:..:.:....:..:...:|....|..|:|     |:....|..... 
Human   280 MESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEG-----TEAAAASSCFVVA 339

  Fly   349 -----NGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
                 :|.: |.|.|||.|:|..|  .||.|.|..:|
Human   340 ECCMESGPR-FCADHPFLFFIRHNRANSILFCGRFSS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 79/358 (22%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 80/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.