DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:371 Identity:77/371 - (20%)
Similarity:145/371 - (39%) Gaps:35/371 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQ-----K 85
            ||..:.:..::.||.||...|.::...:.:|.:.|..::|.:.:::..|.:    |:.|     :
Human    61 LYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEI----PEAQIHEGFQ 121

  Fly    86 IFAMSVKKAPVAKSLTR---FYVRQNMKMSTEYRVFMR---HTEGRARNIAFAREQLDEVNTFYS 144
            ....::.:......||.   .::.:.:|:..::...::   |:|....|.....|...::|.:..
Human   122 ELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVE 186

  Fly   145 HEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDS 209
            .....:|..:|||  ...::...|||.|||...|||.|..:.|...:|.|:...:|.:|||....
Human   187 KGTQGKIVDLVKE--LDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLG 249

  Fly   210 KFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGI 274
            .|.......|.:..:|:.:. |:...:...||: ..|..|:.:|....|.....|.......:.:
Human   250 MFNIQHCKKLSSWVLLMKYL-GNATAIFFLPDE-GKLQHLENELTHDIITKFLENEDRRSASLHL 312

  Fly   275 PKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDV 339
            ||..|....:|.....::||..:|......|.:. .....::...:|.......|:|     |:.
Human   313 PKLSITGTYDLKSVLGQLGITKVFSNGADLSGVT-EEAPLKLSKAVHKAVLTIDEKG-----TEA 371

  Fly   340 GNGSLTHTF-----NGVKYFLATHPFAFYIID-NT-SIYFAGHVTS 378
            .........     ..||:   ..||.|.:|: || |..|.|.|.:
Human   372 AGAMFLEAIPMSIPPEVKF---NKPFVFLMIEQNTKSPLFMGKVVN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 76/367 (21%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 76/367 (21%)
RCL 368..392 4/31 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.