DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINF1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:385 Identity:81/385 - (21%)
Similarity:160/385 - (41%) Gaps:49/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QLPDELYAAIVNSFS------------NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHY-- 71
            ::|....||.|::|.            ..|::.|...:.:::..:.:|.|:.....|.:|::|  
Human    48 KVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDL 112

  Fly    72 ------RGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIA 130
                  .||    ||.....:.|....    .||.:|....:.:::.:.:...:..:.|....:.
Human   113 ISSPDIHGT----YKELLDTVTAPQKN----LKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL 169

  Fly   131 FAREQLD--EVNTFYSHEMGEQIGQVVKESWWKPNSQG-LLVNAIFFNLSWERTFNPEATYPREF 192
            ....:||  |:|.:...:|..::.:..||.   |:... ||:....|...|...|:...|...:|
Human   170 TGNPRLDLQEINNWVQAQMKGKLARSTKEI---PDEISILLLGVAHFKGQWVTKFDSRKTSLEDF 231

  Fly   193 RVNATKSVMIPMMHEDSK--FAFGILGNLKATAVLVPFSHGDLRMLLIKP-DQPDGLAALQMKLQ 254
            .::..::|.:||| .|.|  ..:|:..:|......:|.: |.:.::...| .....|..::..|.
Human   232 YLDEERTVRVPMM-SDPKAVLRYGLDSDLSCKIAQLPLT-GSMSIIFFLPLKVTQNLTLIEESLT 294

  Fly   255 AMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGV 319
            :..|..:.|.|..:...:.:||.|:..:.|::.:.::|.::.:| .|..||.:..:  ..::..|
Human   295 SEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLF-DSPDFSKITGK--PIKLTQV 356

  Fly   320 IHVVTFEFQEQGIG-TPSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHV 376
            .|...||:.|.|.| |||..:....||...:   |.| ..||.|.:  .|..::.|.|.:
Human   357 EHRAGFEWNEDGAGTTPSPGLQPAHLTFPLD---YHL-NQPFIFVLRDTDTGALLFIGKI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/379 (21%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 81/385 (21%)
O-glycosylated at one site 371..383 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.