DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA5

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:422 Identity:89/422 - (21%)
Similarity:176/422 - (41%) Gaps:67/422 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYVLLLILL----GISRYR---AQKNSQLPD-----------------ELYAAIVNSFSNRNIMF 41
            :::||.::|    |.|.:|   .:...::.|                 :||.|:.::..:::|.|
Human     3 LFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFF 67

  Fly    42 STEMIRSSMLFIYVGVEEDESEQI------------RKAMHYRGTHLSEYKPKTQKIFAMSVKKA 94
            |...|..|:..:.:|.......||            .|.:|.....|.:...:.:..|.:|:..|
Human    68 SPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNA 132

  Fly    95 PVAKSLTRFYVRQNMKMSTEYRVFMRHT-EGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKES 158
            .....:...   |:..:|....:::..| ....|:.|.|.:|   :|.:.:.:...:|..::|. 
Human   133 LFTDLVVDL---QDTFVSAMKTLYLADTFPTNFRDSAGAMKQ---INDYVAKQTKGKIVDLLKN- 190

  Fly   159 WWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATA 223
             ...|:..::||.|||...||.:||.:.|..::|.|.:...|.:|||..:.::.:.:..||....
Human   191 -LDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRV 254

  Fly   224 VLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTM-----MDVFVGIPKFKIHSDL 283
            |.||: .|:...|.|.|.:    ..:|.....::..::.:.|.|     ::::  :|||.|....
Human   255 VGVPY-QGNATALFILPSE----GKMQQVENGLSEKTLRKWLKMFKKRQLELY--LPKFSIEGSY 312

  Fly   284 ELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTF 348
            :|......:||.::|......|. :..::|.::..::|....|..|.|....:   ..|:: .||
Human   313 QLEKVLPSLGISNVFTSHADLSG-ISNHSNIQVSEMVHKAVVEVDESGTRAAA---ATGTI-FTF 372

  Fly   349 NGVKY----FLATHPFAFYIIDNTSIYFAGHV 376
            ...:.    .:...||..:|:|| :|.|.|.|
Human   373 RSARLNSQRLVFNRPFLMFIVDN-NILFLGKV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/372 (22%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 81/379 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.