DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINE1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:428 Identity:84/428 - (19%)
Similarity:159/428 - (37%) Gaps:110/428 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILLGIS-------------RYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYV 55
            |..::||::             .|.|...|.....::..:..:..:||::||...:.|.:..:.:
Human     7 LTCLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQL 71

  Fly    56 GVEEDESEQIRKAMHY----RG-----THLSE----------------------------YKPKT 83
            ....:..:||:.||.:    :|     .||.:                            :.|..
Human    72 TTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHF 136

  Fly    84 QKIFAMSVKKAPVAK-SLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEM 147
            .::|..:||:...:: ...||.:...:|         .||:|...|: ..:..:|::...     
Human   137 FRLFRSTVKQVDFSEVERARFIINDWVK---------THTKGMISNL-LGKGAVDQLTRL----- 186

  Fly   148 GEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFA 212
                               :||||::||..|:..|...:|:.|.|..:...:|.:|||.:.:||.
Human   187 -------------------VLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFN 232

  Fly   213 FGILGNLKATAVLVPFS----------HGD-LRMLLIKPDQPD-GLAALQMKLQAMNILSVARNL 265
            :        |....|..          ||| |.|.:..|.:.: .|:||...|.|..|.....|:
Human   233 Y--------TEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNM 289

  Fly   266 TMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQ 330
            |.:...:.:|||.:.::::|....|.:|:.|:|:..::..|.|.......:...:..|..|..|.
Human   290 TRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIEVNES 354

  Fly   331 G-IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN 367
            | :.:.||.|    :.......:..:...||.|.:..|
Human   355 GTVASSSTAV----IVSARMAPEEIIMDRPFLFVVRHN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 78/394 (20%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 81/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.