DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn28F

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:393 Identity:104/393 - (26%)
Similarity:172/393 - (43%) Gaps:48/393 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKA 68
            |.|:||..|     .:.:..|:.|..:....:..|::.|...:..::...|:|.....::::|..
  Fly     4 LCLLLLATS-----VSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNV 63

  Fly    69 MHY---RGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHT---EGRAR 127
            :..   :....::||....|:...  :|........|.||.:..::...|...::.:   |..|.
  Fly    64 LKLPDDKKEVAAKYKDLLSKLEGR--EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAI 126

  Fly   128 NIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREF 192
            :|....:....||.:..::...:|..:|..:... ..:.:::|||:|...||..|||:.|..|.|
  Fly   127 DIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNF 190

  Fly   193 RVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMN 257
            ||:..|||.:.||.....|.......|.|..:.:|:.:..|.||:..|||.|||:.|:.|     
  Fly   191 RVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKK----- 250

  Fly   258 ILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHV 322
            |:.....|:.|||.:.:|||||....:|:.....|||:|.|:.|..|..|: .|:|..:..|||.
  Fly   251 IVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLV-ENSNVHVKKVIHK 314

  Fly   323 VTFEFQEQG---------------IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYF 372
            ...|..|:|               :..||:.:       .||      |.||||:.|.|..:|||
  Fly   315 AFIEVNEEGAEAAAATALLFVRYSMPMPSSQM-------VFN------ADHPFAYVIRDRETIYF 366

  Fly   373 AGH 375
            .||
  Fly   367 QGH 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 98/372 (26%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 99/378 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.