DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn38F

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster


Alignment Length:388 Identity:98/388 - (25%)
Similarity:173/388 - (44%) Gaps:35/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYVLLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQI 65
            |..|.|:||..|     .:.:..|:||..:....:::|::.|...:..::...|:|.....::::
  Fly     1 MKYLCLLLLATS-----VSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEM 60

  Fly    66 RKAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSL------TRFYVRQNMKMSTEYRVFMRHT-E 123
            |..:     .|.:.|.:....|...:.|....:|:      .|.||....|:..||...::.: :
  Fly    61 RDVL-----KLPDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFK 120

  Fly   124 GRARNIAFAREQLDE--VNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEA 186
            ..|..|:....::..  ||.:...:...:|..:|..| ...|...:::|||:|...|::.||.|.
  Fly   121 AEAEAISANNPKITASIVNKWVDTQTSGKIRDLVMPS-DVANLVLVILNAIYFKGQWQKKFNTEQ 184

  Fly   187 TYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQM 251
            | ..:|.::..|||.:.||.....|.......|.|..:.:|:.:.:|.|::..||:.|||..|:.
  Fly   185 T-KSDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK 248

  Fly   252 KLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRI 316
            |:     :.....|..::|.:.:|||||.....|......|||:|.||.|..|:.|: .|:...:
  Fly   249 KM-----VGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLV-ANSGAHV 307

  Fly   317 DGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKY----FLATHPFAFYIIDNTSIYFAGH 375
            .||:|....|..|:|    |......::...:..::.    |...||||:.|.|..:|||.||
  Fly   308 GGVVHKAFLEVNEEG----SEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAENIYFQGH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 91/364 (25%)
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 92/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.