DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and serpinb5

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:366 Identity:83/366 - (22%)
Similarity:150/366 - (40%) Gaps:29/366 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            |:.|..:::..:....:..|.:.|...|.||:..|..|.:.:.:.::.||:|:......::..:.
 Frog     8 NTALAVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKDPDFGFQL 72

  Fly    84 QKIFAMSVKKAPVAKSLTRFYVRQNMKMSTE--------YRVFMRHTEGRARNIAFAREQLDEVN 140
            .......:..|...|.|.|.||..:::...:        |.:.:...:.:::    |.|...::|
 Frog    73 LSSDISKISSANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDFKSQ----AEEARTQIN 133

  Fly   141 TFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMM 205
            :............|:.|.....|::.:::.|..|...|..|||...|...:|.:|..::..:.||
 Frog   134 SSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHINKKETKPVQMM 198

  Fly   206 HEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP----DQPDGLAALQMKLQAMNILSVAR--N 264
            |.:::.:.|.:..||...:.:||......||::.|    |...||..|:   |.|.......  |
 Frog   199 HLEARLSIGYINELKTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLE---QDMTFEKYTHWTN 260

  Fly   265 LTMM---DVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFE 326
            .:||   .|.|.:||||:.:..:|....:.:||.|.|....|..:.:..:....|...|.....|
 Frog   261 PSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESKGISISQAIQKACIE 325

  Fly   327 FQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN 367
            ..|.  ||.|.||   |:.......:.|||.|||.:.:..|
 Frog   326 VDED--GTESADV---SMERRLMNKEEFLADHPFIYILRHN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/360 (23%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 83/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.