DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn27A

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:376 Identity:81/376 - (21%)
Similarity:148/376 - (39%) Gaps:37/376 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFI-------------YVGVEEDESEQIRKAMHYRGTHLS 77
            |...:.|..:::|::.|...::..:..:             ....:.|...|......||.| |:
  Fly    81 LKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKT-LN 144

  Fly    78 EYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTF 142
            .:|.:.|....:||:    .|..|..::....|.:...:.|. .:|..|.:........|.:|.:
  Fly   145 SFKKENQLHETLSVR----TKLFTDSFIETQQKFTATLKHFY-DSEVEALDFTNPEAAADAINAW 204

  Fly   143 YSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHE 207
            .::....::.|:|.....: :|..||.|.|:||..|.|.|  ..|:...|..:.........|.:
  Fly   205 AANITQGRLQQLVAPDNVR-SSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSRAEFMEQ 266

  Fly   208 DSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFV 272
            ...|.:.....|||..:.:|:. |...:.::.|...:|:..|...|:...:.|....:..:.|.|
  Fly   267 TDYFYYTTSEKLKAQILRLPYK-GKNSLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKV 330

  Fly   273 GIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGI----- 332
            .:|||.......|......:|:::||:.|.|...|. |..:  :.|.:.|... .|:.||     
  Fly   331 TLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLT-RGAD--VAGKVKVSNI-LQKAGINVNEK 391

  Fly   333 GTPSTDVGNGSLTHTFNG---VKYFLATHPFAFYIIDNT--SIYFAGHVTS 378
            ||.:.......:.:.|.|   ::.|....||.|:|.:.:  :|.|||.|.|
  Fly   392 GTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 79/372 (21%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 79/372 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.