DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn100A

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:445 Identity:84/445 - (18%)
Similarity:159/445 - (35%) Gaps:109/445 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YRAQKNSQLPDELYAAIVNSFSNRNIM------FSTEMIRSSMLFIYVGVEEDESEQIRKAMHYR 72
            :...|..:|.||...||.:....:.|:      |..::  ....::...|.:.|:|.::|....:
  Fly   189 FETLKRIKLDDEDIPAIPSDGYGQEIIDKEASKFDRDV--DDKQYVEKPVAQAEAELLQKEQKQQ 251

  Fly    73 GTHLSEYKPKTQKIFAMSVKKA----------PVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRAR 127
            .|..||.:.:.::...:||:|.          |..|       :||.:...|        |.:.:
  Fly   252 ATTESELESQPEETTTLSVEKQEKPDMAAEENPAEK-------QQNKRSDQE--------ESQIK 301

  Fly   128 NI-----------------------------------------AFAREQLDE------------- 138
            |:                                         ..|::..||             
  Fly   302 NLEENETVQEEEKLAKIMAAPALTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALESHLPSVS 366

  Fly   139 -VNTFYSHEMGEQIGQVVKESWWKPNSQG-----LLVNAIFFNLSWERTFNPEATYPREFRVNAT 197
             ||...|....:.|...:..:.....|.|     ||.|.:::..||...|........||.....
  Fly   367 RVNGARSLFQQDDITSALSANSITGRSAGSKSKMLLFNGLYYRGSWANPFYQLRDGSDEFFFMTN 431

  Fly   198 K-SVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSV 261
            : :|..||||...||....|..:||..:.:|:......:.::.||:.:||:.:..:||..:.|..
  Fly   432 EDAVKAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLA 496

  Fly   262 ARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFE 326
            .:...|.::.:.:|||::..........::||:|.:|..:::..:||..:.:..:|.::..|...
  Fly   497 KKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKVFSRTEAQLSLLSEDPDVHVDEIVQFVNVR 561

  Fly   327 FQEQG-----IGTPSTDVGNGSLTHT----------FNGVKYFLATHPFAFYIID 366
            ..|.|     :...:......|:..|          ..||:.|....|||::|:|
  Fly   562 VDEGGSSANSLSAATMQARTPSVESTVLPVPEPEPELPGVERFEVNRPFAYFIVD 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/434 (19%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 53/237 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.