DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn85F

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:331 Identity:69/331 - (20%)
Similarity:118/331 - (35%) Gaps:94/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LSEYKP----KTQKIFAMSVKKAPVA---KSLTRFYVR------QNMKMSTEYRVFMRHTEGRAR 127
            ::|.||    :...|.|.||:.|.::   |:.|..|.|      :::..:....:|..||.....
  Fly   343 VAERKPPGTRQVISIIAPSVQPANISVTRKTKTARYKRHAIPAYKDLDANLFLTLFNPHTHVPHH 407

  Fly   128 NI--------AFAREQLDEVNTFYSHEMGEQI-------GQVVKESWWKPNSQGLLVNAIFFNLS 177
            .:        |||    ...|.|..|.:||..       ..|:...::..|.|  :|:..|    
  Fly   408 PLHFPPPVPAAFA----PITNDFEPHYIGEAAEGKSNYNTDVISHVFYLGNQQ--VVHTTF---- 462

  Fly   178 WERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQ 242
              :.:| ...|.:.|.                        :||.:.:.:.....:..::::.||.
  Fly   463 --KVYN-AVLYYKYFE------------------------HLKMSVLELELDTPEYNLMILLPDY 500

  Fly   243 PDGLAALQMKLQAMNILSVAR-NLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS-FS 305
            ...:.|....|:....|.:.| .|....|...||.||:|..:.|:...:.|||.|:|:|::: |.
  Fly   501 HTDIVAAAASLKLGPTLRLMRKQLKPRWVQAIIPDFKLHGTMFLTNDLQNMGICDVFEPNRADFR 565

  Fly   306 TLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK----------YFLATHPF 360
            .:......:    |.|:      ||.|.....       ||..|.:|          .....|||
  Fly   566 PMTEEKGVY----VRHI------EQSIDVTIR-------THPINQLKRNYGAQSKPIQISVNHPF 613

  Fly   361 AFYIID 366
            .|:|:|
  Fly   614 LFFIVD 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 69/331 (21%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 45/220 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.