DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and serpine2

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:391 Identity:80/391 - (20%)
Similarity:156/391 - (39%) Gaps:25/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILLGISRYRAQ------KNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDES 62
            :|.:|..:|..::|      :.|.|..:::..::...:..|::.|...:.|.:..:..|...|..
Zfish     9 VLFLLCSVSVSQSQSSSYGARGSDLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTR 73

  Fly    63 EQIRKAMHYRGTHLSEYKPKTQKIFAMSVK-KAPVAKSLTRFYVRQNMKMSTEYRVFMRHT---E 123
            .|:...:.|:..  ..||...:...:::.| .|.:.......:..:...|..::....|..   |
Zfish    74 RQLLNGLKYKKN--GPYKMLRKLHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCE 136

  Fly   124 GRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLL-VNAIFFNLSWERTFNPEAT 187
            ..:.:.:........:|.:..:....||..||....:......|: ||:|||...|:..|.|::|
Zfish   137 SHSVDYSDPEAAAQSINDWVKNSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQST 201

  Fly   188 YPREFRVNATKSVMIPMMHEDSKFAFGILG---NLKATAVLVPFSHGDLRMLLIKP-DQPDGLAA 248
            .||.|......:..:|||.:.|.|..|...   ..|...:.:|:....:.|.:..| :....|::
Zfish   202 KPRSFTAGDGNTYKVPMMSQLSVFNMGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDSTPLSS 266

  Fly   249 LQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS-FSTLLHRNT 312
            :...:....|.|..:.:....:.:.:|||.:..:|:|....:.:||||||..:|: |..|  .:.
Zfish   267 ILPHISTNTIQSWTKLMNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHL--SSE 329

  Fly   313 NFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTS--IYFAGH 375
            :..:...:.....|..|.|....:|   ...:.|..:...:.....||.|.|..|:|  |.|||.
Zfish   330 SIYVSKALQKAKIEVNEDGTKASAT---TSVILHARSSPPWVTVDRPFLFLIRHNSSGTILFAGQ 391

  Fly   376 V 376
            :
Zfish   392 I 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 74/362 (20%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 76/374 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.