DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA2

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:396 Identity:79/396 - (19%)
Similarity:150/396 - (37%) Gaps:73/396 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQ 84
            :.|..:||..:.:.....|::.:...:..:...:.:|.:.|...:|.:.::...|...|  .|..
Human    58 TDLAFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPE--AKIH 120

  Fly    85 KIFAMSVKKAPVAKSLTR------------FYVRQNMKMSTEY-----RVFMRHTEGRARNIAFA 132
            :.|..      |.::|:|            .:|.::||:...:     :::  |:|..:.|....
Human   121 ECFQQ------VLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLY--HSEASSINFRDT 177

  Fly   133 REQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNAT 197
            .|..:::|.:.....|.::..:||.  .|.::...||:.|.|:..|:..|..|......|.|:..
Human   178 EEAKEQINNYVEKRTGRKVVDLVKH--LKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDK 240

  Fly   198 KSVMIPM--------MHEDSKFAFGIL-----GNLKATAVLVPFSHGDLRMLLIKPDQPDGLAAL 249
            ..:.:||        :|.|.:.:..:|     ||  |||            ..|.|| |..:..|
Human   241 TIIRVPMINHLGRFDIHRDRELSSWVLAQHYVGN--ATA------------FFILPD-PKKMWQL 290

  Fly   250 QMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNF 314
            :.||...::.::.|...:..:.:..||..|....:|......:||..||......|. :.:....
Human   291 EEKLTYSHLENIQRAFDIRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSG-VSQEAPL 354

  Fly   315 RIDGVIHVVTFEFQEQG---IGTPSTDVGNGSLTHT--FNGVKYFLATHPFAFYIIDNTSIY--F 372
            ::...:||......|:|   .|.|..:....|...|  ||        .||...|.|:.:.:  |
Human   355 KLSKAVHVAVLTIDEKGTEATGAPHLEEKAWSKYQTVMFN--------RPFLVIIKDDITNFPLF 411

  Fly   373 AGHVTS 378
            .|.|.:
Human   412 IGKVVN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 77/387 (20%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 78/392 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.