DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb1c

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:373 Identity:89/373 - (23%)
Similarity:167/373 - (44%) Gaps:31/373 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHY---RGTHLSEYKPKTQKI 86
            ||:..:..|....|.:||...|.|::..:|:|.....:.|:.|.:|:   ...| |:::..|.::
Mouse    47 ELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFDSAEDIH-SQFQSLTAEV 110

  Fly    87 FAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAF------AREQLDEVNTFYSH 145
            .....  :...|...|.|..:......||...::.|  .:.::|.      :.:...|:|.:...
Mouse   111 SKRGA--SHTLKLANRLYGEKTYNFLPEYLASIQKT--YSADLALVDFQHASEDARKEINQWVKG 171

  Fly   146 EMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSK 210
            :..|:|.::.........::.:||||.:|...|::.|....|....||::...:..:.||:..:.
Mouse   172 QTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMMYLKNN 236

  Fly   211 FAFGILGNLKATAVLVPFSHGDLRMLLIKP----DQPDGLAALQMKLQAMNILSVARNLTMMDVF 271
            ..||.:.:||...:.:|:..|:|.|:::.|    |:..||..::.:| .:..|....||..:||.
Mouse   237 LPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQL-TLEKLQECENLQNIDVC 300

  Fly   272 VGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGT-- 334
            |.:||||:.....|:....::|::|:|..||:..:.:..:.:..|..::|....|..|:|..|  
Mouse   301 VKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGTETDA 365

  Fly   335 --PSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTS--IYFAGHVTS 378
              |.|.||...:...|.      ..|||.|:|..|.:  :.|.|.|.|
Mouse   366 AMPGTVVGCCLMPMEFT------VDHPFLFFIRHNPTAHVLFLGRVCS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 87/369 (24%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 89/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.