DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and AT1G62160

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:239 Identity:55/239 - (23%)
Similarity:81/239 - (33%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 FFNLSWERTFNPEATYPREFRVNA-----TKSVMI-------PMMHEDSKFAFGILGNLKATAVL 225
            ||.||:.:..:.:       .:||     ..||.:       |.|.....|....:.......||
plant    16 FFILSFLKASSTD-------ELNAVLRKIASSVFVDGSKKGGPKMRGHKNFEKQYIAAYDGFKVL 73

  Fly   226 -VPFSHG------DLRMLLIKPDQPDGLAALQMKLQAM-NILS--VARNLTMMDVFVGIPKFKIH 280
             :|:..|      :..|....||:...|..|..::.:. ..|.  ..|....:|.| .||||||.
plant    74 RLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTPRERVEVDEF-RIPKFKIE 137

  Fly   281 SDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTF------EFQEQG----IGTP 335
            ...|.|..|                      ::|.||     |:|      |..|:|    ..|.
plant   138 FGFEASSVF----------------------SDFEID-----VSFYQKALIEIDEEGTEAAAATA 175

  Fly   336 STDVGNG-SLTHTFNGVKYFLATHPFAFYIIDNT--SIYFAGHV 376
            ..|..:| ....|.:    |:|.|||.|.|.:..  ::.|||.:
plant   176 FVDNEDGCGFVETLD----FVADHPFLFLIREEQTGTVLFAGQI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 55/237 (23%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 47/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.