DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and serpind1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:403 Identity:89/403 - (22%)
Similarity:175/403 - (43%) Gaps:54/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLGISRYRAQK----NSQLPDELYAAIVNSFSNR-NIMFSTEMIRSSMLFIYVGVEEDESEQ- 64
            |:.|...:.|.|:    |::....||..:.|..:.. ||:.:...|..:|..:.:||..:..|| 
Zfish   121 LLRLFHGQTRLQRINVVNARFGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQL 185

  Fly    65 ---------IRKAMHYRGTHLSE-YKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFM 119
                     :..:.||..:.:.: ::..|.::|..:.  ....:|:...||::|:::...:|   
Zfish   186 FQTVGFAEFVNASNHYDNSTVHKLFRKLTHRLFRRNF--GYTLRSVNDLYVKRNVQIQDSFR--- 245

  Fly   120 RHTEGRARNIAFAREQ-LDEVNTFYSHEMGEQIGQV----VKESWWK--PNSQGLLVNAIFFNLS 177
                ..|:...||..| :|..:..:..:..::|.::    :||....  ||...:|:|.::|..:
Zfish   246 ----ADAKTYYFAEPQSVDFADPAFLVKANQRIQKITKGLIKEPLKSVDPNMAVMLLNYLYFKGT 306

  Fly   178 WERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQ 242
            ||:.|..|.|:.|:||||..|.|.:.||.....:.......|....:.:|:: |::.||:..|.:
Zfish   307 WEQKFPKELTHHRQFRVNEKKQVRVLMMQNKGSYLAAADHELNCDILQLPYA-GNISMLIAVPQK 370

  Fly   243 PDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTL 307
            ..|:.:|:.::....:.....|:|.....|..|:||:..:.:|....::||:.|||.....||.:
Zfish   371 LSGMRSLEQEISPTLVNKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPM 435

  Fly   308 LHRNTNFRIDGVIHVVTFEFQEQG---IGTPSTDVGNGSLTH----TFNGVKYFLATHPFAFYII 365
            ....          |:...|:.||   :....|:.  .::||    ..:....|:...||.|.|.
Zfish   436 TSEK----------VIINWFKHQGSITVNEEGTEA--AAMTHIGFMPLSTQTRFIVDRPFLFLIY 488

  Fly   366 DNTS--IYFAGHV 376
            ::.:  :.|.|.|
Zfish   489 EHRTGCVVFMGRV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 83/378 (22%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 89/403 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.