DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn28Da

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:372 Identity:93/372 - (25%)
Similarity:168/372 - (45%) Gaps:34/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQK 85
            |...:||.:.:......||:.|...:...|..|.:|.:.:.:.::|.|:     :|.|.|.....
  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL-----NLPEDKKNVAT 75

  Fly    86 IFAMSV------KKAPVAKSLTRFYVRQNMKMSTEY-RVFMRHTEGRARNIAFAREQLD---EVN 140
            |:...:      ||..:.....|.:|.:.:.::..| ::..:|....|..|..| ::|.   .:|
  Fly    76 IYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLA-DRLKAAWAIN 139

  Fly   141 TFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMM 205
            .:...:..:.:..::..|...|:...:::||.||...|:..|:...|.|:.|.|:.:..|.:.||
  Fly   140 DWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMM 204

  Fly   206 HEDSKFAFGILGNLKATA----VLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLT 266
            .:..:|      .::.:.    :.:||::.:|.|:::.|.....|...:..:::...:.    ||
  Fly   205 SQVGRF------KMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV----LT 259

  Fly   267 MMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG 331
            .|||.|.:|||||...:||....:.|||:|:|..|...|.||:: :..||..|:|....|..|:|
  Fly   260 EMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQ-SGTRISQVVHKAFIEIDEEG 323

  Fly   332 --IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAGHV 376
              .|:.|.....| |:.....|..|....||.|.|.|:.:|||.|.|
  Fly   324 GSAGSASASPIRG-LSDYATSVVTFTVNSPFVFMIRDDDNIYFRGRV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 91/366 (25%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 92/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.