DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina7

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:356 Identity:81/356 - (22%)
Similarity:135/356 - (37%) Gaps:62/356 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            |:.....||..:.....:.||.||...|..::..:..|.......||.:.:   |.:|::     
Mouse    57 NADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVL---GFNLTD----- 113

  Fly    84 QKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQ-------LDEVNT 141
                      .||.:....|   |::..|..:.  ....|.:..|..|..:|       ||:|.|
Mouse   114 ----------TPVTELQQGF---QHLICSLNFP--KNELELQMGNAVFIGQQLKPLAKFLDDVKT 163

  Fly   142 FYSHEMGEQIGQVVKESWWKPNS--------------QGL-------LVNAIFFNLSWERTFNPE 185
            .|..|:.......|..:..|.||              |||       |||.|.|...|...|...
Mouse   164 LYETEVFSTDFSNVSAAQHKINSYVEKQTKGKIVGLIQGLKLNIIMILVNYIHFRAQWANPFRVS 228

  Fly   186 AT-YPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLI-KPDQPDGL-A 247
            .| ....|.|:.:.:|.:||||:..::...:...|..|.:.:.:|...|.:.:: |....:.: |
Mouse   229 KTEESSNFSVDKSTTVQVPMMHQLEQYYHYVDMELNCTVLQMDYSENALALFVLPKEGHMEWVEA 293

  Fly   248 ALQMK-LQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRN 311
            |:..| |:..|.|   .....:::||  |||.|.:..:|....:|||::|.|..|..|..:. .:
Mouse   294 AMSSKTLKKWNYL---LQKGWVELFV--PKFSISATYDLGSTLQKMGMRDAFAESADFPGIT-ED 352

  Fly   312 TNFRIDGVIHVVTFEFQEQGIGT-PSTDVGN 341
            :..::....|.......|:|... .|.:||:
Mouse   353 SGLKLSYAFHKAVLHIGEEGTKEGASPEVGS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/350 (23%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 81/356 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.