DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA9

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:393 Identity:93/393 - (23%)
Similarity:163/393 - (41%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSE---YK 80
            |:.....||..:|....::||.||...:.:|:..:.:|.......||.:.:.:..||..|   ::
Human    48 NTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQ 112

  Fly    81 PKTQKIFAMSVKKAPVAKSLT-----RFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVN 140
            .....:.:::|.    :|.||     ..:|::.:::...:          ..|:    ::|.|..
Human   113 GFQHLVHSLTVP----SKDLTLKMGSALFVKKELQLQANF----------LGNV----KRLYEAE 159

  Fly   141 TFYSHEMGEQIGQVVKESWWKPNSQG---------------LLVNAIFFNLSWERTFNPEAT--- 187
            .|.:......|.|....|..|..:||               :|||.|||...||:.|:||.|   
Human   160 VFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKN 224

  Fly   188 YPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMK 252
            :|  |.|....:|.:||||:..:||||:...|....:.:.:. ||.....:.|.: ..:..|:..
Human   225 FP--FLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYK-GDAVAFFVLPSK-GKMRQLEQA 285

  Fly   253 LQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRID 317
            |.|..:...:.:|....:.|.||:|.|.:...|.....||||:::|..:..||.:..|: :.::.
Human   286 LSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRD-SLQVS 349

  Fly   318 GVIHVVTFEFQEQGIGTPSTDVGNGSLTHTF-----NGVKYFLATHPFAF-YIIDNTS---IYFA 373
            ...|....:..|:  ||.:|    .:.|..|     :|..||..:....| .:|.|.:   |.|.
Human   350 KATHKAVLDVSEE--GTEAT----AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFL 408

  Fly   374 GHV 376
            |.|
Human   409 GKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 91/385 (24%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.