DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpine3

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:368 Identity:69/368 - (18%)
Similarity:135/368 - (36%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAMS 90
            ||.:.....:..|.:.|...:..|:..:..|...:...|:..|:.|     :...|:        
Mouse    39 LYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGY-----TVQDPR-------- 90

  Fly    91 VKKAPVAKSLTRFYVRQNMKMSTEYRVFMR----------HTEGRARNIAFAREQLDEVNTFYSH 145
            ||:...|...||....|.:.|.....:||:          ....|..|.:.......|.|:..:.
Mouse    91 VKEFLHAVYTTRHNSSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAADFSEPNSTTTE 155

  Fly   146 EMGEQIGQVVKES-----WWKP---NSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMI 202
            .......|...|.     |.:.   ::|..:::.:.|..:|::.|: ....|..|.......:.:
Mouse   156 ASKVTSRQSTGEGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFS-VVLQPLPFTHAHGLVLQV 219

  Fly   203 PMMHEDSKFAFG----ILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQA--MNILSV 261
            |.||:.::.::|    ..|:..|...|:........:|::..|:...|..::..|.|  :::.:.
Mouse   220 PAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARVLHLWTT 284

  Fly   262 ARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFE 326
            ......||||  :|:|||.:..::.......||.|:|.|.|:....:.....|.:..:.|....|
Mouse   285 RLKRARMDVF--LPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGISGQDGFYVSQLTHKAKME 347

  Fly   327 FQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTS 369
            ..|:|   ..:......|....:....|.|..||.|.:.::::
Mouse   348 LSEEG---TRSSAATAVLLLRRSRTSAFKADRPFIFLLREHST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 69/368 (19%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 69/368 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.