DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Spn75F

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster


Alignment Length:392 Identity:73/392 - (18%)
Similarity:159/392 - (40%) Gaps:61/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRK 67
            ||:..|:.:.::....|.::  .|...:......||.::|...||.::..:|:..:....:|:..
  Fly     5 VLICFLIFLLKHSYAYNFEI--NLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLES 67

  Fly    68 AMHYRGTH----LSEYKPKTQKI----FAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEG 124
            |:...|.:    :|.:|...:|:    |.|.          .|.|:..:...|........:...
  Fly    68 ALQLTGLNQEEIISLFKEAREKVAQEQFTMG----------NRIYLSPDYNASPNITQLSENLGV 122

  Fly   125 RARNIAFAREQ--LDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWE-------- 179
            ..:|:.|:.:|  ..|:..:.:..:|:..|.:..::.....:|.:.|..:.::..|:        
  Fly   123 EVKNMTFSGDQSAASEIKKWLNKWIGKAGGNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTN 187

  Fly   180 RTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPD 244
            |||.......:.| |..|:     ||:.::...|  ..|.:...|:|||.:.|:.||::.|....
  Fly   188 RTFTLLRQNKKPF-VYTTQ-----MMYTEAPMDF--FNNDQVRGVMVPFKNSDMGMLVLLPRPRY 244

  Fly   245 GLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLH 309
            ....:...|..:..:.:.|:   ....:.:||||:...::|:.|.:.:||:::|..:.:      
  Fly   245 STQQILYSLDTILKIKLRRS---KKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNA------ 300

  Fly   310 RNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAG 374
              .||:     ...:|:..:..: ..:.|||:     .|:. :.......|.|.:.|.::||..|
  Fly   301 --ANFK-----QYNSFDADQNRV-LMTIDVGD-----DFDD-RVVYVNRGFVFVVKDKSTIYMIG 351

  Fly   375 HV 376
            .:
  Fly   352 RM 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 69/368 (19%)
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 70/374 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.