DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb9d

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:372 Identity:76/372 - (20%)
Similarity:150/372 - (40%) Gaps:83/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IYVGVEEDESEQIRKAMHYRGTHLSE-------------YKPKT-------QKIFAMSV-KKAPV 96
            :.:|.:.|.:.||.:|::. ..|..|             .|||:       .::||.:. |..|.
  Rat     2 VLLGAKGDTAVQISQALNL-NKHPDEDIHKDFQLLLHNLNKPKSHYCLRIANRLFAENTCKLVPT 65

  Fly    97 AK-SLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAR---EQLDEVNTFYSHEMGEQIGQVVKE 157
            .| |..|||                  ......::||:   |....:||:.|.:...:|.:::..
  Rat    66 YKESCLRFY------------------NSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSS 112

  Fly   158 SWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKAT 222
            ......::.::|||::|..||...|:.|.|....|::|..::..:.||.::..|....:..::|.
  Rat   113 DSVGSETKLIMVNALYFQGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQ 177

  Fly   223 AVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTM--------------MDVFVG 273
            .:::|:...::..:::.||            :.::|..|..:||.              .:|:|.
  Rat   178 ILVMPYRGMEMSFMVLLPD------------EGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVY 230

  Fly   274 IPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTD 338
            :|||::....:::..|:.:|:.|:|...|:..:.:....:..:...:|....|..|:|....:..
  Rat   231 LPKFQLQEQYDMTALFQHLGMIDVFSEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAAS 295

  Fly   339 VGN-----GSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
            ..:     ...|.|      |.|..||.|:|..|  .||.|.|..:|
  Rat   296 AADCCYSCSEYTPT------FCADRPFLFFIRHNQTNSILFCGRFSS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 75/368 (20%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 76/372 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.