DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and RGD1564786

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:401 Identity:94/401 - (23%)
Similarity:167/401 - (41%) Gaps:35/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYVLLL-ILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQ 64
            |::::| ..|.|.....:.|.....:|:..:....| :|:.||...|.|::..|.:|.....:.|
  Rat    31 MFIVILHSRLTIMDPLLKANGNFAIKLFKVLGEDIS-KNVFFSLPSISSALSMILMGANGTTASQ 94

  Fly    65 IRKAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQ--NMKMSTEYRVFMRHTEGRAR 127
            |.:||.....:........|...::..|   |.|:.||..:|:  ::.:...:.:.....:...:
  Rat    95 ICQAMSLDKCNSIGGGDVHQHFLSLLTK---VNKTDTRCMLRKANSVFIEDSFEILASFKDACHK 156

  Fly   128 NIAFAREQLD----------EVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTF 182
            ......|:||          .:||:.:.:..:.|.:::.......|:...|||.|:|..|.|:.|
  Rat   157 LYEAEIEELDFKGAPEQSRQHINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPF 221

  Fly   183 NPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLA 247
            |...|....|:|:..:...:.||.:.|.|....:.::....:.:||.:..|.|....||......
  Rat   222 NKADTREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQR 286

  Fly   248 ALQMKLQAMNILSVARNLTM----MDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS-FSTL 307
            .|:.:|.....|......||    |:||  :|:.|:....:::....|:|:.|.|:..|: ||.:
  Rat   287 KLENELTYDKFLEWTDEDTMEEKEMEVF--LPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGI 349

  Fly   308 LHRNTNFRIDGVIHVVTFEFQEQGI-GTPSTDV--GNGSLTHTFNGVKYFLATHPFAFYIIDNTS 369
            ..::..| :..|:|....|..|:|. ....|||  ....||     .:..:|.|||.|.|.|..|
  Rat   350 SSKHGLF-LSKVVHKSFVEMSEEGTEAAAPTDVVTMKSPLT-----PRCLIADHPFLFSIQDTRS 408

  Fly   370 --IYFAGHVTS 378
              |.|.|..:|
  Rat   409 KEILFLGRFSS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 88/372 (24%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 90/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.