DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPIND1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:402 Identity:87/402 - (21%)
Similarity:172/402 - (42%) Gaps:46/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILLGISRYRAQK--NSQLPDELYAAI---VNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESE 63
            :|.:..|.||.:...  |::....||..:   ||:|.  ||..:...|.::|..|.:|::.:..|
Human   113 ILQLFHGKSRIQRLNILNAKFAFNLYRVLKDQVNTFD--NIFIAPVGISTAMGMISLGLKGETHE 175

  Fly    64 QIRKAMHYRG-----------THLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRV 117
            |:...:|::.           |..:.::..|.::|..:.  ....:|:...|:::...:..:::.
Human   176 QVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNF--GYTLRSVNDLYIQKQFPILLDFKT 238

  Fly   118 FMRHTEGRARNIAFAREQLDE------VNTFYSHEMGEQIGQVVKESWWK--PNSQGLLVNAIFF 174
                   :.|...||..|:.:      ::...:|.|....| ::|::...  |.:|.:::|.|:|
Human   239 -------KVREYYFAEAQIADFSDPAFISKTNNHIMKLTKG-LIKDALENIDPATQMMILNCIYF 295

  Fly   175 NLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIK 239
            ..||...|..|.|:...||:|..:.|.:.||.....|.......|....:.:.:. |.:.||::.
Human   296 KGSWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVV 359

  Fly   240 PDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSF 304
            |.:..|:..|:.:|....:....:::|.....|.:||||:..:..|..:.:.|||:.:|..:.:.
Human   360 PHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNM 424

  Fly   305 STLLHRNTNFRIDGVIHVVTFEFQEQGI-GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN- 367
            :.:  .:....||...|..|....|:|. .|..|.||...|:....    |....||.|.|.:: 
Human   425 AGI--SDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVR----FTVDRPFLFLIYEHR 483

  Fly   368 -TSIYFAGHVTS 378
             :.:.|.|.|.:
Human   484 TSCLLFMGRVAN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/375 (22%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 87/402 (22%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.