DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinc1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:423 Identity:94/423 - (22%)
Similarity:159/423 - (37%) Gaps:106/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFS-NRNIMFSTEMIRSSMLFIYVG-----------------VEEDES 62
            ::.||:.....|..:.:|.: |.||..|...|.::.....:|                 :.|..|
  Rat    85 SKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFDTISEKTS 149

  Fly    63 EQIR------KAMHYRGTHLSEYKPKTQKIFA----------MSVKKAPVAKSLTRFYVRQNMKM 111
            :||.      ....||..:.|.......::|.          ..|.:......|.....::|.:.
  Rat   150 DQIHFFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQ 214

  Fly   112 STEYRVFMRH-----TEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNA 171
            |   ||.:.:     ||||.::: ..:..:||:...                        :|||.
  Rat   215 S---RVTINNWVANKTEGRIKDV-IPQGAIDELTAL------------------------VLVNT 251

  Fly   172 IFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVL-VPFSHGDLRM 235
            |:|...|:..|:||.|....|.....:|.::|||:::.||.:..:|  :.|.|| :||...|:.|
  Rat   252 IYFKGLWKSKFSPENTRKEPFHKVDGQSCLVPMMYQEGKFKYRRVG--EGTQVLEMPFKGDDITM 314

  Fly   236 LLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKP 300
            :||.|.....||.::.:|....:......|:.:.:.|.:|:|:|.....|....:.||:.|:|.|
  Rat   315 VLILPKPEKSLAKVEQELTPELLQEWLDELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSP 379

  Fly   301 SKSFSTLLHRNTNFRIDGVI-------------HVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK 352
            .||           ::.|:|             |....|..|:|    |....:.|:..|...:.
  Rat   380 EKS-----------QLPGIIAEGRDDLFVSDAFHKAFLEVNEEG----SEAAASTSVVITGRSLN 429

  Fly   353 ----YFLATHPFAFYIID---NTSIYFAGHVTS 378
                .|.|..||...|.:   || |.|.|.|::
  Rat   430 PSRVTFKANRPFLVLIREVALNT-IIFMGRVSN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 91/410 (22%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 93/419 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.