DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina3m

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:342 Identity:70/342 - (20%)
Similarity:142/342 - (41%) Gaps:54/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            |:.....||..:.....::|::||...|.:::..:.:|.:.:..|:|.:.:.:..|  ..|:...
  Rat    51 NTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLT--ESYETDI 113

  Fly    84 QKIFAMSVKK----APVAKSLT--RFYVRQNMKMSTEYRVFMRHT-EGRARNIAFAREQLDE--V 139
            .:.|...:::    ....|.:|  ..::.:|:::..|::...|.. :..|....|.:.::.|  :
  Rat   114 HQGFGHLLQRLSQPGDQVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRVTEKLI 178

  Fly   140 NTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPM 204
            |.:..::...:|.::|  |..|..:..:|||.:.|...|:..|:|:.|:..||.|:..:||.:.|
  Rat   179 NDYVRNQTQGKIQELV--SGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVSM 241

  Fly   205 M---------HEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPD-----------QPDGLAAL 249
            |         ..|.:.:..:| .||.|        |:...|.|.||           ||:.|...
  Rat   242 MKIEELTTPYFRDEELSCSVL-ELKYT--------GNSSALFILPDKGRMQQVEASLQPETLKKW 297

  Fly   250 QMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNF 314
            :..|:...|..:.           :|:..|.:|..|.....::||:|:|......|.:.... :.
  Rat   298 KDSLRPRKIDELY-----------LPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAK-DL 350

  Fly   315 RIDGVIHVVTFEFQEQG 331
            .:..|:|.|..:..|.|
  Rat   351 SVSQVVHKVVLDVNETG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 69/336 (21%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 69/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.