DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina9

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:403 Identity:91/403 - (22%)
Similarity:165/403 - (40%) Gaps:85/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            |::....||..:......:||:||...|.:|:..:.:|.......||.:::.:..||::|:    
  Rat    49 NTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGFNITHIAEH---- 109

  Fly    84 QKIFAMSVKKAPVAKSLTR------------FYVRQNMKMSTEY----------RVFMRHTEGRA 126
                .:.:....:..||..            .::|:.:::..::          :||.....   
  Rat   110 ----TIHLGFEQLVHSLNECHKDLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFS--- 167

  Fly   127 RNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQG--LLVNAIFFNLSWERTF---NPEA 186
             |...|:.|   :|::...|...::..|:::.    :||.  :|||.|||..:|.:.|   |...
  Rat   168 -NAVTAQAQ---INSYVERETKGKVVDVIQDL----DSQTAMVLVNHIFFKANWTQPFSAANTNK 224

  Fly   187 TYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQM 251
            ::|  |.::...:|.:||||:...||||:...|..:.:.:.: .||.....:.|.: ..:..|:.
  Rat   225 SFP--FLLSKGTTVHVPMMHQTESFAFGVDRELGCSILQMDY-RGDAVAFFVLPGK-GKMRQLER 285

  Fly   252 KLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNF-R 315
            .|....:...:|:|....:.|.||||.|.:...|.....:|||:|.|..:..||.:  ..|:| :
  Rat   286 SLSPRRLRRWSRSLQKRWIKVFIPKFSISASYNLETILPEMGIRDAFNSNADFSGI--TKTHFLQ 348

  Fly   316 IDGVIHVVTFEFQEQGI---------------GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYII 365
            :....|....:..|:|.               .|||:       |..||        .||...::
  Rat   349 VSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSS-------TIAFN--------EPFLILLL 398

  Fly   366 D-NT-SIYFAGHV 376
            | || ||.|.|.|
  Rat   399 DKNTESILFLGKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 89/395 (23%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 91/403 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.