DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina16

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:400 Identity:76/400 - (19%)
Similarity:137/400 - (34%) Gaps:84/400 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            |.:....||..:......:|::||...|...::.:....:.....|:.:.:.:..|...:.|..:
  Rat    48 NQKFALSLYKQLPQPKRGKNLIFSPLGIIVPLVLLAFQDKPKARHQVLQDLGFTVTGALDTKAAS 112

  Fly    84 QKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRAR--------------------N 128
            :           ..|.|:.....:|..:.|...:|:..|...|:                    |
  Rat   113 E-----------YGKLLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGN 166

  Fly   129 IAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFR 193
            ...|::|:|......:|....::.:::     ||.:...|.|..||...|:..||.:.|..|.|.
  Rat   167 YGLAQKQIDLAIRARTHGKITKLLRIL-----KPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFW 226

  Fly   194 VNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDG------LAALQMK 252
            :......::|||.....|.......:.:..:.:||: ..:..:...||  ||      .|.|:..
  Rat   227 LEDGTKTLVPMMQRVGWFQLQYFSQMHSYVLQLPFT-CSISGVFFLPD--DGKFEESEKALLEQS 288

  Fly   253 LQAMNILSVARNLTMMDVFVGIPKFKI----------HSDLELSPAFEKMGIKDIF--KPSKSFS 305
            .:..     .:...|...::..|||.|          |.:..:....|.|.:..|.  |...:.|
  Rat   289 FETW-----IQPFPMSKRWLFFPKFSIPVALHLENLKHVNSNIKLFSEHMDLSRITLQKAPLTVS 348

  Fly   306 TLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNT-- 368
            |.:||        |...|..:.:|:....|..|:.    |..||        ..|...|:|.|  
  Rat   349 TAVHR--------VELTVNEDGEEKDESQPEPDLA----TLHFN--------RSFLLLILDETSN 393

  Fly   369 SIYFAGHVTS 378
            |:.|.|.|.:
  Rat   394 SLLFMGKVVN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 74/390 (19%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 76/399 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.