DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina6

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:396 Identity:88/396 - (22%)
Similarity:146/396 - (36%) Gaps:95/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            |..|......||..:|....::|.:.|...|..::..:.:|..:.:|.|   ::.:..|..||  
  Rat    35 APTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQTQSLQ---SLGFNLTETSE-- 94

  Fly    81 PKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMS-TEYRVFMRHTEGRARNIAFAREQLDEVNTFYS 144
                         |.:.:|..  |:...:|.| |...:.|.:.....:.:......|.:|..:|.
  Rat    95 -------------AEIHQSFQ--YLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYE 144

  Fly   145 HE-----------MGEQIGQVVKESWWKPNSQG---------------LLVNAIFFNLSWERTFN 183
            .|           ..:||.|.||:     .:||               :|||.||....||..|:
  Rat   145 SEALAIDFEDWTKASQQINQHVKD-----KTQGKIEHVFSDLDSPASFILVNYIFLRGIWELPFS 204

  Fly   184 PEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAV---LVPFSH-GDLRMLLIKPDQPD 244
            ||.|...:|.||.|.:|.:|||.:.     |.:|..:.:..   |:...: |:.....|.|||  
  Rat   205 PENTREEDFYVNETSTVKVPMMVQS-----GSIGYFRDSVFPCQLIQMDYVGNGTAFFILPDQ-- 262

  Fly   245 GLAALQMKLQAMNILSVAR---NLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFS- 305
              ..:...:.|::..::.|   .:|...|.:.||||.|....:|....|.:.|||:......|| 
  Rat   263 --GQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFSG 325

  Fly   306 -------TLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFN---GVKYFLATHPF 360
                   ||.          ::|....:..|..:...||   ||:..|..:   .:|:   ..||
  Rat   326 NTKDVPLTLT----------MVHKAMLQLDEGNVLPNST---NGAPLHLRSEPLDIKF---NKPF 374

  Fly   361 AFYIID 366
            ...:.|
  Rat   375 ILLLFD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 86/387 (22%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 87/394 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.