DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serping1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:380 Identity:72/380 - (18%)
Similarity:141/380 - (37%) Gaps:65/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELYAAI-VNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFA 88
            :||.|. ....:..|:.||...|.|.:..:.:|..:.....:...:.|         ||.   ||
  Rat   157 KLYHAFSATKKAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSY---------PKD---FA 209

  Fly    89 M--SVKKAPVAKSLTRF--------------YVRQNMKM-STEYRVFMRHTEGRARNIAFAREQL 136
            .  ...||..:|.:|..              ||..::.: .:..||.  ..:|.|        .|
  Rat   210 CVHQTLKAFSSKGVTSVSQIFHSPDLAIRDTYVNASLSLYGSSPRVL--GPDGDA--------NL 264

  Fly   137 DEVNTFYSHEMGEQIGQVVKESWWKPNSQGL-LVNAIFFNLSWERTFNPEATYPREFRVNATKSV 200
            ..:||:.:.....:|.:::..   .|:...| |:||::.:..|::||..:.........|:  .:
  Rat   265 KLINTWVAENTNHKINELLDS---LPSDTRLVLLNAVYLSAKWKKTFEQKKMMASFLYKNS--MI 324

  Fly   201 MIPMMHEDSKFAFGILGN--LKATAVLVPFSHGDLRMLLIKPDQP-DGLAALQMKLQAMNILSVA 262
            .:||: ...|:...:..:  |||....:..|| :|..:::.|..| ..|..::..|......::.
  Rat   325 KVPML-SSKKYPLALFNDQTLKAKVGQLQLSH-NLSFVIMVPQSPTHQLEDMEKALNPTVFKAIL 387

  Fly   263 RNLTM---MDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTL-LHRNTNFRIDGVIHVV 323
            :.|.:   ...:|.:|:.|:.|..::....||:   :.|..:...:.. |..:.:.::..:.|..
  Rat   388 KKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKL---EFFDFTYDLNLCGLTEDPDLQVSSMKHET 449

  Fly   324 TFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIY--FAGHV 376
            ..|..|.|:     :....|.......:..|....||.|.:.|....:  |.|.|
  Rat   450 VLELTETGV-----EAAAASTISVARNLLIFEVQQPFLFLLWDQRHKFPVFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 71/378 (19%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 71/378 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.