DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:365 Identity:81/365 - (22%)
Similarity:164/365 - (44%) Gaps:21/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAM---HYRGTHLSEYKPKTQKIFAMSV 91
            ::...|::|:.||...:.||:..|.:|.....:.||.|.:   :..|....::....|.:.. .|
  Rat    18 VLGEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQCFQSLLT-EV 81

  Fly    92 KKAP---VAKSLTRFYVRQNMKMSTEYRVFMR-HTEGRARNIAF--AREQ-LDEVNTFYSHEMGE 149
            .|:.   :.|:....:|..:.::...::...| ..|....|:.|  |.|| ...:||:.:.:..:
  Rat    82 NKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHINTWVAKKTED 146

  Fly   150 QIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFG 214
            .|.:::.......|:|.:|:|:.:|..:||:.||.|.|....|:|:..:..::.||...|.|...
  Rat   147 VIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQMMFNKSNFRTY 211

  Fly   215 ILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVAR--NLTMMDVFVGIPKF 277
            .:.::..|..|:|:....|.:.::.||:...|..::.::....::...|  |:...:|.:.:|:|
  Rat   212 HVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQEEEVEILLPRF 276

  Fly   278 KIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG--IGTPSTDVG 340
            |:....::.....|:|:.:.|:..::..:.:.......:..|:|....|..|:|  ...|:..|.
  Rat   277 KLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKPGLFLSKVVHKSVVEVNEEGTEAAAPTEIVT 341

  Fly   341 NGSLTHTFNGVKYFLATHPFAFYIID--NTSIYFAGHVTS 378
            .||..    ..:..:|.|||.|.|.|  |.:|.|.|..:|
  Rat   342 MGSPL----SPQCLVADHPFLFLIQDDRNKAILFLGRFSS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/361 (22%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.