DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb8

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:368 Identity:81/368 - (22%)
Similarity:158/368 - (42%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRG---------THLSEY-KPKTQKIFAMS 90
            :||:.|....:.|::..:|:|.:.:.:.|:.:.:...|         |.|:|. |..||.:...:
  Rat    25 SRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGDGDVHQGFQTLLAEVNKSGTQYLLKSA 89

  Fly    91 VK---------KAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHE 146
            .:         .:...:|..:||.....:||     |::.|||..:.|          |.:...:
  Rat    90 CRLFGEESCDFLSTFKESCQKFYQAGIEEMS-----FVKDTEGCRKRI----------NDWVLEK 139

  Fly   147 MGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKF 211
            ...:|.:|:......|.::.:||||::|...|:..|:.:.|....|:.|..:...:.||.:.:||
  Rat   140 TEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQMMFKHAKF 204

  Fly   212 AFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKL--QAMNILSVARNLTMMDVFVGI 274
            ....:..:.|..:.:|::..:|.|:::.||:...|..::..|  :.:...:....||...|.|..
  Rat   205 KMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFF 269

  Fly   275 PKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTD- 338
            |:.|:....:|....:.:|:.|.|:.:|:..:.:....|..:..|.|....|..|:|....:|. 
  Rat   270 PRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEAAATTA 334

  Fly   339 -VGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHVTS 378
             :.|   |.:......|.|..||.|:|  ...:||.|.|..:|
  Rat   335 VIRN---TRSCRIEPRFCADRPFLFFIWHQKTSSILFCGRFSS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/364 (22%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 81/368 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.