DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinf1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:361 Identity:74/361 - (20%)
Similarity:160/361 - (44%) Gaps:21/361 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAM 89
            :||.....:.|..||:.|...:.:::..:.:|.|:.....|.:|::|...:..:.....:::.|.
  Rat    64 DLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPDIHSTYKELLAS 128

  Fly    90 SVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLD--EVNTFYSHEMGEQIG 152
            ........||.:|....:.:::.:.:...:..:.|....|.....::|  |:|.:...:|..:|.
  Rat   129 VTAPEKNFKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRIDLQEINNWVQAQMKGKIA 193

  Fly   153 QVVKESWWKPNSQG-LLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSK--FAFG 214
            :..:|   .|::.. ||:...:|...|...|:...|..::|.::..::|.:||| .|.|  ..:|
  Rat   194 RSTRE---MPSALSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTVRVPMM-SDPKAILRYG 254

  Fly   215 ILGNLKATAVLVPFSHGDLRMLLIKP-DQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFK 278
            :..:|......:|.: |.:.::...| .....|..::..|.:..:..:.|.|..:...:.:||.|
  Rat   255 LDSDLNCKIAQLPLT-GSMSIIFFLPLTVTQNLTMIEESLTSEFVHDIDRELKTIQAVLTVPKLK 318

  Fly   279 IHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPST-DVGNG 342
            :..:.:::.:.:.|.::.:|: |..||.:..:..  ::..|.|...||:.|:|.||.|. |:...
  Rat   319 LSYEGDVTNSLQDMKLQSLFE-SPDFSKITGKPV--KLTQVEHRAAFEWNEEGAGTSSNPDLQPV 380

  Fly   343 SLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHV 376
            .||...:   |.| ..||.|.:  .|..::.|.|.:
  Rat   381 RLTFPLD---YHL-NRPFIFVLRDTDTGALLFIGRI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 74/359 (21%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 74/361 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.