DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina5

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:407 Identity:83/407 - (20%)
Similarity:155/407 - (38%) Gaps:108/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFIYVG----------------VEEDESEQIRK------- 67
            ||.|:|:....:|:.||...:..|:..:.:|                :::.:.:::.|       
Mouse    50 LYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLHKGFQQLLQ 114

  Fly    68 ---------------------AMHYRGTHLSEYKP-KTQKIFAMSVKKAPVAKSLTRFYVRQNMK 110
                                 |:|.|...||..|. .....|:.:.....:||.....||     
Mouse   115 RFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNYV----- 174

  Fly   111 MSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFN 175
                    .:.|:|:.  :.|.:: ||.     :|.|                   ::||.|||.
Mouse   175 --------AKQTKGKI--VDFIKD-LDS-----THVM-------------------IVVNYIFFK 204

  Fly   176 LSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP 240
            ..|:..|:...|:..:|.|...::..:|||:.:..:::.:..|:..|.|.:|: .|:...|.|.|
Mouse   205 AKWQTAFSETNTHKMDFHVTPKRTTQVPMMNREDGYSYYLDQNISCTVVGIPY-QGNAIALFILP 268

  Fly   241 DQ------PDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFK 299
            .:      .|||....::    |.|.:... ..:|::  :|||.|.:..:|.....|:||:|:|.
Mouse   269 SEGKMKQVEDGLDERTLR----NWLKMFTK-RRLDLY--LPKFSIEATYKLENVLPKLGIQDVFT 326

  Fly   300 PSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK----YFLATHPF 360
            .....|.:.. :||.::..::|....|.:|.|    :|.........||...:    ....|.||
Mouse   327 THADLSGITD-HTNIKLSEMVHKSMMEVEESG----TTAAAITGAIFTFRSARPSSLKIEFTRPF 386

  Fly   361 AFYIIDNTSIYFAGHVT 377
            ...:::::.|.|.|.||
Mouse   387 LLTLMEDSHILFVGKVT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/404 (20%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 83/407 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.