DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb10

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:399 Identity:90/399 - (22%)
Similarity:163/399 - (40%) Gaps:62/399 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQ 84
            :|...|....:..|...|||.||...|.:|:..:|:|.:...:.|:.:.:|:......::.|.::
  Rat     9 NQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDSE 73

  Fly    85 K--------------------IFAMSVK--KAPVAKSLTRFYVRQNMKMSTEYRVFMR---HTEG 124
            |                    :.|..:|  .:.|.|...|.||.:......:|...|:   ..|.
  Rat    74 KKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAEP 138

  Fly   125 RARNIAFAREQL-DEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATY 188
            ::.|...|..|: .|:|::...:.|.:|..::.:......:..:||||::|..:||..|:.:.|.
  Rat   139 QSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQNTT 203

  Fly   189 PREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKL 253
            .|.||:|.|.|..:.||..........:..|:...|.:.:.:.:..:||:.|::.:||..|:..:
  Rat   204 ERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEVEGLKQLERAI 268

  Fly   254 QAMNILSVARNLTMMDVF---VGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFR 315
             ....|....:..|||.:   :.:||||:....:|..|...||:.|.|...|:..:.:....|..
  Rat   269 -TYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTSERNLF 332

  Fly   316 IDGVIHVVTFEFQEQG--------------IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYI-- 364
            :..|.|....|..|:|              |..||.::.               |.|||.|.|  
  Rat   333 LSNVFHKTFLEINEEGTEAAAGTGSEVNFRIKAPSIELN---------------ADHPFLFLIRH 382

  Fly   365 -IDNTSIYF 372
             :.||.:::
  Rat   383 NVTNTILFY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 89/394 (23%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 90/399 (23%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.