DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA11

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:375 Identity:85/375 - (22%)
Similarity:148/375 - (39%) Gaps:62/375 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSE------YKPKTQKIFAMSVK-KAP 95
            ||.||...|.:::..:.:|.:.:.|..|.:.:.:..|...|      ::.....:...|.| :..
Human    72 NIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADIHQGFRSLLHTLALPSPKLELK 136

  Fly    96 VAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQI--------- 151
            |..||   ::.:.:|....|...::...|.   .||:....|.|.|      |.||         
Human   137 VGNSL---FLDKRLKPRQHYLDSIKELYGA---FAFSANFTDSVTT------GRQINDYLRRQTY 189

  Fly   152 GQVV---KESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPRE-FRVNATKSVMIPMMHEDSKFA 212
            ||||   .|  :..::..:|.|.|||...|:..|:...|..:| |.|:...|:.:||||:.....
Human   190 GQVVDCLPE--FSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR 252

  Fly   213 FGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNL--TMMDVFVGIP 275
            |....:|..|.:.:.: .|:...||:.|| |..:..::..||...:....:.|  :::|:.  :|
Human   253 FLYDQDLACTVLQIEY-RGNALALLVLPD-PGKMKQVEAALQPQTLRKWGQLLLPSLLDLH--LP 313

  Fly   276 KFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGT------ 334
            :|.|.....|.....::|:.:|......||.:..: .|..|..|.|....:..|:|...      
Human   314 RFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQ-LNKTISKVSHKAMVDMSEKGTEAGAASGL 377

  Fly   335 ----PSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHVTS 378
                ||.:..:....| ||        .||...:  :...|:.|.|.|.:
Human   378 LSQPPSLNTMSDPHAH-FN--------RPFLLLLWEVTTQSLLFLGKVVN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 84/371 (23%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 84/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.