DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina3n

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:345 Identity:75/345 - (21%)
Similarity:146/345 - (42%) Gaps:46/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNSQLPDELYAAIVN---SFS----------NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAM 69
            |.:|| |.|..|.:|   :||          ::|::||...|.:::..:.:|.:.:..|:|.:.:
  Rat    38 KGTQL-DSLTLASINTDFAFSLYKKLALRNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGL 101

  Fly    70 HYRGT------------HLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYR---VFM 119
            .:..|            ||.:...:.:....:|...|        .::.:.:::..|::   ..:
  Rat   102 KFNLTETPETEIHRGFGHLLQRLSQPRDEIQISTGNA--------LFIEKRLQVLAEFQEKAKAL 158

  Fly   120 RHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNP 184
            ...|....:...:||....:|.:.|.:...:|..::.....|.:.  :|||.|:|...|:..|:|
  Rat   159 YQAEAFTADFQQSREAKKLINDYVSKQTQGKIQGLITNLAKKTSM--VLVNYIYFKGKWKVPFDP 221

  Fly   185 EATYPREFRVNATKSVMIPMMH-EDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAA 248
            ..|:..||.....:.|.:|||. ||....:.....|..|.|.:.:: |:...|.|.||| ..:..
  Rat   222 RDTFQSEFYSGKRRPVKVPMMKLEDLTTPYVRDEELNCTVVELKYT-GNASALFILPDQ-GKMQQ 284

  Fly   249 LQMKLQAMNILSVARNL--TMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRN 311
            ::..||...:.....:|  :|:|... :|||.|.:|..|.....::|||::|......|.:. .:
  Rat   285 VEASLQPETLRRWKDSLRPSMIDELY-LPKFSISADYNLEDVLPELGIKEVFSTQADLSGIT-GD 347

  Fly   312 TNFRIDGVIHVVTFEFQEQG 331
            .:..:..|:|....:..|.|
  Rat   348 KDLMVSQVVHKAVLDVAETG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 71/338 (21%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 75/345 (22%)
RCL 367..394 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.