DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina3c

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:438 Identity:97/438 - (22%)
Similarity:151/438 - (34%) Gaps:144/438 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTH----- 75
            |..|:.....||..:.....::|::||...|.:::..:.:|.::...|:|.:.:.:..|.     
  Rat    46 ASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEE 110

  Fly    76 -----------------------------------LSEYKPKTQKI-----FAMSVKKAPVAKSL 100
                                               |||::.||:.:     |....|:...||..
  Rat   111 IHQGFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNEAKKF 175

  Fly   101 TRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQ 165
            ...||             ...|:|:   ||.....|||                        .:.
  Rat   176 INDYV-------------SNQTQGK---IAELFSDLDE------------------------RTS 200

  Fly   166 GLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMH---------EDSKFAFGILGNLKA 221
            .:|||.:.|...|:..|||..|:..||.::..:||.:|||.         .|.:.:..:| .||.
  Rat   201 MVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKIKDLTTPYVRDEELSCSVL-ELKY 264

  Fly   222 TAVLVPFSHGDLRMLLIKPD-----------QPDGLAALQMKLQAMNILSVARNLTMMDVFVGIP 275
            |        |:...|.|.||           ||:.|...:..|:. .|:|..|          :|
  Rat   265 T--------GNASALFILPDQGKMQQVESSLQPETLKKWKDSLRP-RIISELR----------MP 310

  Fly   276 KFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGI-GTPSTDV 339
            ||.|.:|..|.....::||:.||......|.:. ...|..:..|:|....:..|.|. |..:|.|
  Rat   311 KFSISTDYNLEEVLPELGIRKIFSQQADLSRIT-GTKNLHVSQVVHKAVLDVDETGTEGAAATAV 374

  Fly   340 GNG--SLTHT-----FNGVKYFLATHPFAFYIIDNT--SIYFAGHVTS 378
            ...  ||..|     ||        .||...|.||.  |::|.|.||:
  Rat   375 TAALKSLPQTVPLLNFN--------RPFMLVITDNNGQSVFFMGKVTN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 93/425 (22%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 95/430 (22%)
RCL 365..392 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.