DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:384 Identity:89/384 - (23%)
Similarity:155/384 - (40%) Gaps:48/384 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPD---ELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            :|.|.|   .||..:|:..:..||.||...|.::...:.:|.:.|..:||.:.:.:..|.:.|  
  Rat    45 SSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPE-- 107

  Fly    81 PKTQKIFAMSVKKA--PVAKSLTR------------FYVRQNMKMSTEYRVFMR---HTEGRARN 128
                    ..:.||  .:.::|.|            .:|.:|:|:..::...::   |:|..:.|
  Rat   108 --------ADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVN 164

  Fly   129 IAFAREQLDEVNTFYSHEMGEQIGQVV---KESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPR 190
            .|.:.|....:|.:.  |.|.| |::|   |:  ...::...|||.|||...|:|.||||.|...
  Rat   165 FADSEEAKKVINDYV--EKGTQ-GKIVDLMKQ--LDEDTVFALVNYIFFKGKWKRPFNPEHTRDA 224

  Fly   191 EFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDG-LAALQMKLQ 254
            :|.|:.:.:|.:|||:....|.......|.:..:::.:. |:...:.:.||  || :..|:..|.
  Rat   225 DFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYL-GNATAIFLLPD--DGKMQHLEQTLT 286

  Fly   255 AMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGV 319
            ...|.....|.......:..||..|.....|......:||..:|......|.:. .:...::...
  Rat   287 KDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGIT-EDAPLKLSQA 350

  Fly   320 IHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAGHV 376
            :|.......|:|.......|...........||:   .|||.|.|:::  .|..|.|.|
  Rat   351 VHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKF---DHPFIFMIVESETQSPLFVGKV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 85/373 (23%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 86/378 (23%)
RCL 367..386 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.