DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpine1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:368 Identity:79/368 - (21%)
Similarity:150/368 - (40%) Gaps:75/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHY----RGT 74
            :.||:.:....:::..:|.:..:||::||...:.|.:..:.:.......:||:.||.:    |||
  Rat    30 HTAQQATNFGVKVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISERGT 94

  Fly    75 HLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEV 139
                               ||..:           |:|.|........|....:..|.:..|:.|
  Rat    95 -------------------APALR-----------KLSKELMGSWNKNEISTADAIFVQRDLELV 129

  Fly   140 NTFYSH---------------EMGEQIGQVVKESWWKPNSQGL-----------------LVNAI 172
            ..|..|               ||  :..:.:...|.:.:::|:                 ||||:
  Rat   130 QGFMPHFFKLFRTTVKQVDFSEM--ERARFIINDWVERHTKGMISDLLAKGAVNELTRLVLVNAL 192

  Fly   173 FFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKF---AFGILGNLKATAVLVPFSHGD-L 233
            :||..|:..|...:|:.|.|..:...::.:|||.:::||   .|......:...:.:|: ||: |
  Rat   193 YFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNYTEFTTPDGHEYDILELPY-HGETL 256

  Fly   234 RMLLIKPDQPD-GLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDI 297
            .|.:..|.:.| .|:|:...|.|..|.....|:|.:...:.:|||.:.::::|....||:|:.||
  Rat   257 SMFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDLRGPLEKLGMTDI 321

  Fly   298 FKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG-IGTPSTDV 339
            |..:::..|.|.......:...:..|..|..|.| :.:.||.:
  Rat   322 FSSTQADFTSLSDQEQLSVAQALQKVKIEVNESGTVASSSTAI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 77/357 (22%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 79/368 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.