DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb13

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:386 Identity:90/386 - (23%)
Similarity:165/386 - (42%) Gaps:54/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMH-YRGTHLSEYKPKTQKIFAMSVKKA 94
            :|..::.|:.||...|.:::..|.:|.....:.:::|.:: .:||..|..|.:.::|    .|:.
Mouse    19 LNKTNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEEEI----EKRE 79

  Fly    95 PVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQV--VKE 157
            .:...| :..:.:..|.|.:|.:.:.:.....:...|.::.:|.|..:| |...|.:..|  ..|
Mouse    80 EIHHQL-QMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYY-HASLEPVDFVNAADE 142

  Fly   158 SWWKPNS---------------QG--------LLVNAIFFNLSWERTFNPEATYPREFRVNATKS 199
            |..|.||               :|        :|:|.::|...|:|.|..|.|...:|.:|...|
Mouse   143 SRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNKNLS 207

  Fly   200 VMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNIL--SVA 262
            ..:.||...|.|.|..|.:|:|..|.:|:.:.|:.|.::.|:..|||..:..|:....::  :..
Mouse   208 KPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPEKLVEWTSP 272

  Fly   263 RNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIH----VV 323
            .:|....|.:.:|:.::....:|.|..|.:||...|.....:|.:..| :.......:|    ||
Mouse   273 GHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSAR-SGLHAQNFLHRSFLVV 336

  Fly   324 TFEFQE----QGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHVTS 378
            |.|..|    .|:|...:...:..|.|         ..|||.|:|  .::.||.|.|..:|
Mouse   337 TEEGVEATAGTGVGLKVSSAASCELVH---------CNHPFLFFIRHRESDSILFFGKFSS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 89/382 (23%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 90/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.