DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina3f

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:425 Identity:83/425 - (19%)
Similarity:149/425 - (35%) Gaps:134/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTH----- 75
            |..|:.....||..:|....:.|::||...|.:::..:.:|.:.:..::|.:.:.:..|.     
Mouse    38 ASSNTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPD 102

  Fly    76 -----------------------------------LSEYKPKTQKIFAMSVKKAPVAKSLTRFYV 105
                                               |:|:|.|.:.::......|...:.|     
Mouse   103 IHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPL----- 162

  Fly   106 RQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVN 170
             :..|:..:|  ...||:|:.:.:.   ..||:                        .:..:|||
Mouse   163 -EATKLINDY--VSNHTQGKIKELI---SDLDK------------------------RTLMVLVN 197

  Fly   171 AIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGN----------LKATAVL 225
            .|:|...||..|:|:.|...||.::..:||.:|||.         :.|          |..|.|.
Mouse   198 YIYFKGKWEMPFDPDDTCKSEFYLDENRSVKVPMMK---------INNLTTPYFRDEELSCTVVE 253

  Fly   226 VPFSHGDLRMLLIKPD-----------QPDGLAALQ--MKLQAMNILSVARNLTMMDVFVGIPKF 277
            :.:: |:...:.|.||           ||:.|...:  :|.:.:|.|.             :|||
Mouse   254 LKYT-GNASAMFILPDQGKMQQVEASLQPETLRNWKDSLKPRLINELC-------------LPKF 304

  Fly   278 KIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNG 342
            .|.:|..|.....::||:::|......|.:. ...:.|...|:|....:..|.|     |:...|
Mouse   305 SISTDYSLEHILPELGIRELFSTQADLSAIT-GTKDLRTSQVVHKAVLDVAETG-----TEAAAG 363

  Fly   343 SLTHTF---NGVKYFLATH---PFAFYIID-NTSI 370
            :.....   .||.|.:..:   ||...|.| ||.|
Mouse   364 TGYQNLQCCQGVIYSMKIYFDRPFLMIISDTNTHI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/416 (19%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 82/423 (19%)
RCL 357..382 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.