DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb8

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:388 Identity:84/388 - (21%)
Similarity:165/388 - (42%) Gaps:44/388 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRG------- 73
            ::.|......|...:.....:||:.|....:.|::..:|:|.:.:.:.|:.:.:...|       
Mouse     5 SEANGSFAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGDVHQS 69

  Fly    74 --THLSEY-KPKTQKIFAMSVK---------KAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRA 126
              |.|:|. |..||.:...:.:         .:...:|..:||     :...|...|.:.|||..
Mouse    70 FQTLLAEINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFY-----QAGLEELSFAKDTEGCR 129

  Fly   127 RNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPRE 191
            ::|          |.:.|.:...:|.:|:......|.::.:||||::|...|:..|:.:.|....
Mouse   130 KHI----------NDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMP 184

  Fly   192 FRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKL--Q 254
            |:.|..|.. :.||.:.:||..|.:..:....:.:|::..:|.|:::.||:...||.::..|  :
Mouse   185 FKTNQEKKT-VQMMFKHAKFKMGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYE 248

  Fly   255 AMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGV 319
            .:...:....||...|.|.:|:.|:....:|....:.:|:.|.|:.:::..:.:....|..:..|
Mouse   249 KLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTTKKNVPVSKV 313

  Fly   320 IHVVTFEFQEQG--IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
            .|....|..|:|  ....:..:.|.....|   ...|.|.|||.|:|..:  :||.|.|..:|
Mouse   314 AHKCFVEVNEEGTEAAAATAVIRNARCCRT---EPRFCADHPFLFFIWHHKTSSILFCGRFSS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 82/375 (22%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 84/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.