DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb6a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:376 Identity:88/376 - (23%)
Similarity:164/376 - (43%) Gaps:43/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAM---HYRGTHLSEYKPKTQKIFAMSV 91
            |:...|::|:..|...|.|::..:::|.:...:.|:.:|:   ...|....:.....|.:.    
Mouse    39 ILGEDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDKCSGNGGGDVHQGFQSLL---- 99

  Fly    92 KKAPVAKSLTRFYVRQNMKMSTEYRVF---------------MRHTEGRARNIAF---AREQLDE 138
              ..|.|:.|::.:|      |..|:|               ::..|.....:.|   ..|....
Mouse   100 --TEVNKTGTQYLLR------TANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEESRQH 156

  Fly   139 VNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIP 203
            :||:.:.:..::|.:|:.......::..:|||||:|..:||:.||.|.|....|:|:..:...:.
Mouse   157 INTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVSKNEEKPVQ 221

  Fly   204 MMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMM 268
            ||.:.|.|....:|.:....:|:|:...:|.|:::.||:...|:.::.::.....:...| |..|
Mouse   222 MMFKKSTFKMTYIGEIFTKILLLPYVSSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTR-LDKM 285

  Fly   269 D---VFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQ 330
            |   |.|.:||||:..:..::.|..|:|:.|.|.....||.:..:...| :..|:|....|..|:
Mouse   286 DEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLF-LSKVVHKAFVEVNEE 349

  Fly   331 GIGTPSTDVGNGSLT-HTFNGVKYFLATHPFAFYI--IDNTSIYFAGHVTS 378
              ||.:.....|.:| ........|.|.|||.|:|  :....|.|.|..:|
Mouse   350 --GTEAAAATAGMMTVRCMRFTPRFCADHPFLFFIHHVKTNGILFCGRFSS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 87/372 (23%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 88/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.