DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina3n

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:384 Identity:84/384 - (21%)
Similarity:151/384 - (39%) Gaps:62/384 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSE-- 78
            |..|:.....||..:|....::||:||...|.:::..:.:|.:.:..|:|.:.:.:..|..||  
Mouse    48 ASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEAD 112

  Fly    79 ------------YKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMR---HTEGRARN 128
                        .:||.|  ..:|...|        .::.:..::.||::...|   ..|....:
Mouse   113 IHQGFGHLLQRLNQPKDQ--VQISTGSA--------LFIEKRQQILTEFQEKARALYQAEAFTAD 167

  Fly   129 IAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFR 193
            ....|:....:|.:...:....|.::|.:  ....:..:|||.|:|...|:..|:|..|:..||.
Mouse   168 FQQPRQAKKLINDYVRKQTQGMIKELVSD--LDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFY 230

  Fly   194 VNATKSVMIPMMH-EDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMN 257
            ....:.|::|||. ||....:.....|..|.|.:.:: |:...:.|.||| ..:..::..||...
Mouse   231 AGKRRPVIVPMMSMEDLTTPYFRDEELFCTVVELKYT-GNASAMFILPDQ-GKMQQVEASLQPET 293

  Fly   258 ILSVARNL--TMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVI 320
            :.....:|  .|:|. :.:|||.|.:|..|.....|:||:::|......|.:. ...:.|:..|:
Mouse   294 LRKWKNSLKPRMIDE-LHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAIT-GTKDLRVSQVV 356

  Fly   321 HVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK-------------YFLATHPFAFYIID 366
            |....:..|.|....:.           .|||             ||  ..||...|.|
Mouse   357 HKAVLDVAETGTEAAAA-----------TGVKFVPMSAKLYPLTVYF--NRPFLIMIFD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 82/375 (22%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 84/384 (22%)
RCL 367..392 4/35 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.