DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb9e

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:402 Identity:89/402 - (22%)
Similarity:166/402 - (41%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMH-------YRG 73
            :|.|......|...:.....:.|:.:|...|.|::..:.:|.:.|.:.||.:|:|       ::|
Mouse     5 SQANGTFAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDEDVHQG 69

  Fly    74 THLSEY---KPKTQKIFAMSVKKAPV----------AKSLTRFYVRQNMKMSTEYRVFMRHTEGR 125
            ..|..:   ||..||.......:..|          .||..:||                |:|  
Mouse    70 FQLLLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFY----------------HSE-- 116

  Fly   126 ARNIAF---AREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEAT 187
            ...::|   |.|....:|.:.|.:...:|..::.|......::.:|.||::|..:|.:.|..::|
Mouse   117 IEQLSFAEAAEESRQHINMWVSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDST 181

  Fly   188 YPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMK 252
            ....|::|..::..:.||.::..|....:..::|..:::|:...||..:::.||           
Mouse   182 KEVPFKINKKETRPVQMMWQEDTFFHAYVKEIQAQVLVMPYEGIDLNFVVLLPD----------- 235

  Fly   253 LQAMNILSVARNLTM--------------MDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS 303
             |.::|..|..|||.              .::.|.:||||:..|.:::...:.:||.|:|..||:
Mouse   236 -QGVDISKVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKA 299

  Fly   304 FSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNT 368
            ..:.:....|..:...:|....|..|:|....:...|...|.......:.|.|.|||.|:|:.:|
Mouse   300 DFSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASAGKIILFCDGPDPEVFCADHPFLFFIMHST 364

  Fly   369 --SIYFAGHVTS 378
              ||.|.|..:|
Mouse   365 TNSILFCGRFSS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 86/389 (22%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 89/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.