DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb9c

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:373 Identity:77/373 - (20%)
Similarity:164/373 - (43%) Gaps:22/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKP 81
            :.|......|...:.|:..::|:.:|...|.|::....:||:.:...||.:|:.. .|.:..:: 
Mouse    33 EANGTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGL-NTAIDIHQ- 95

  Fly    82 KTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMR-------HTEGRARNIAFAR---EQL 136
              ..::.:::.|.|..|...|...|...:.:.|:....:       |.|  ..::.|.:   |..
Mouse    96 --SFLWILNILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWE--MEHLPFTKAPEEAR 156

  Fly   137 DEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVM 201
            :.:||:.......:|.:::........::.:||||::|...|...|:.::|....|::|..:...
Mouse   157 NHINTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERP 221

  Fly   202 IPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQ--MKLQAMNILSVARN 264
            :.||.::..|....:..::...:::|:...:|.::::.||....|:.::  :..:.::..:....
Mouse   222 VQMMFQEDMFKLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDY 286

  Fly   265 LTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQE 329
            |....|.|.:||||:....::...|:.:|:.|||:..|:..:.:.......:...|.....|..|
Mouse   287 LKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPERGLCVSKFIQKCVVEVNE 351

  Fly   330 QGI-GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAG 374
            :|. .|.:|.........|.:| :.|.|.|||.|:|..|  .||.|.|
Mouse   352 EGTEATAATADDTVCSAETHDG-QTFCADHPFLFFIRHNKTNSILFCG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 76/365 (21%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 77/373 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.