DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb9b

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:379 Identity:86/379 - (22%)
Similarity:165/379 - (43%) Gaps:23/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAM---HYRGTHLS 77
            ::.|......|...:..|..::|:.||...|.|::..:.:|.:|..:.||.:|:   ..:|.|..
Mouse     5 SEANGTFAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGLKKEKGIHQG 69

  Fly    78 EYK-----PKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLD 137
            ..|     .|..:.:::.|.....|.....  |.|..|.|.     .|..:.....:.|.:..::
Mouse    70 FLKLLRKLNKPDRKYSLIVANRLFADKTCE--VLQTFKESC-----FRFYDSEMEQVNFFKAAVE 127

  Fly   138 E---VNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKS 199
            .   :||:.|.:...:|.:::.:......::.:||||::|...|...|..|:|....|.:|..:.
Mouse   128 SRQCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEK 192

  Fly   200 VMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARN 264
            ..:.||.:...|.|..:..|.|..:::|:...:|.::::.|::...|:.::..|....:::..:.
Mouse   193 RPVQMMCQTDTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVENDLTFEKLIAWTKP 257

  Fly   265 LTM--MDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEF 327
            ..|  .:|.|.:||||:..|.|:....:.:||.|:|:..|:..:.:....|..:...||....|.
Mouse   258 DIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNLCLSKFIHKSVVEV 322

  Fly   328 QEQGIGTPSTDVGNGSLTHTF-NGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
            .|:|....:.....|.:.... .|..:|.|.|||.|:|..|  .||.|.|..:|
Mouse   323 NEEGTEAAAASSAEGIIPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCGRFSS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 84/366 (23%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 86/379 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.